PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041672t1
Common NameTCM_041672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MYB
Protein Properties Length: 308aa    MW: 34492.8 Da    PI: 9.8397
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041672t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.96.3e-102874347
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      +WT+eE + + +a + + ++   +W ++a++++ g+t  +++  ++k+
  Thecc1EG041672t1 28 KWTPEENKMFENALAVHDKDnpdRWQKVAAMIP-GKTVPDVIKQYRKL 74
                      8********************************.***********997 PP

2Myb_DNA-binding48.22.6e-15135179347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  Thecc1EG041672t1 135 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 179
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-52373IPR009057Homeodomain-like
PROSITE profilePS512938.6132479IPR017884SANT domain
SMARTSM007172.5E-102577IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-112782IPR009057Homeodomain-like
CDDcd001671.52E-82874No hitNo description
PfamPF002493.8E-82874IPR001005SANT/Myb domain
PROSITE profilePS5129420.955128184IPR017930Myb domain
SuperFamilySSF466895.46E-17129183IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-18131183IPR006447Myb domain, plants
SMARTSM007172.7E-13132182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-13132179IPR009057Homeodomain-like
CDDcd001671.71E-11135180No hitNo description
PfamPF002495.4E-13135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MKWEMEILSP TSYISSTNWF LEESKSTKWT PEENKMFENA LAVHDKDNPD RWQKVAAMIP  60
GKTVPDVIKQ YRKLEADVSS IEAGLVPIPG YSTSPFTLDW VNSHGYDGLK HSYGLGGKRP  120
SSGRPAEQER KKGVPWTEEE HKLFLMGLKK YGKGDWRNIS RNFVVTRTPT QVASHAQKYF  180
IRQLSGGKDK RRASIHDITT VNLNDTRTPS PDNKGTPSPE QSSVLPQQPT SAAMPRTHFQ  240
WNQPCSGATM AFNSTQGNML MSSPYGIPSY GVKMQGQSLH RSAAHESYFG PQNLVFQMQS  300
AQQYPHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1529941176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016182.10.0DIV1A protein
SwissprotQ8S9H71e-147DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A061GWE30.0A0A061GWE3_THECC; DIV1A protein
STRINGPOPTR_0001s25590.10.0(Populus trichocarpa)
STRINGPOPTR_0009s04730.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-111Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]